Crispy Baked Falafel Recipe

Crispy Baked Falafel Recipe

Crunchy on the outside, fluffy green on the inside — baked, not fried

By Sarah Mitchell June 14, 2026

Prep: 20 min
Cook: 25 min
Servings: 6
Difficulty: Medium
falafelmiddle-easternvegetarianchickpeabakedhealthy
Pin This Recipe

These baked falafel are crispy on the outside with a bright green, herb-packed interior — all without deep frying. The secret is using dried chickpeas soaked overnight (never canned, which are too soft).

The mixture of chickpeas, fresh parsley, cilantro, cumin, and garlic gets pulsed into a coarse paste that holds together when baked.

Serve in warm pita with tahini sauce, pickled onions, and crunchy vegetables.

About This Recipe

"Crispy Baked Falafel" is a Dinner recipe that brings dried chickpeas, soaked overnight, fresh parsley, fresh cilantro, garlic and onion, quartered together into a flavorful, well-balanced dish. Rated Medium and ready in about 45 minutes, this recipe fits easily into a busy schedule. It serves 6 and works equally well for a weeknight dinner or a relaxed weekend meal. The Middle Eastern inspiration behind this dish balances classic techniques with clean, vibrant flavors.

Ingredients

  • 1 lb dried chickpeas, soaked overnight
  • 1 cup fresh parsley
  • 1/2 cup fresh cilantro
  • 4 cloves garlic
  • 1 small onion, quartered
  • 2 tsp ground cumin
  • 1 tsp ground coriander
  • 1/2 tsp cayenne pepper
  • 3 tbsp flour
  • 1 tsp baking powder
  • 3 tbsp olive oil
  • 1 tsp salt

Instructions

  1. 1

    Drain soaked chickpeas. Add to food processor with herbs, garlic, onion, and spices.

  2. 2

    Pulse until a coarse, sandy texture forms. Do not over-process into hummus.

  3. 3

    Mix in flour and baking powder. Refrigerate 30 minutes.

  4. 4

    Form into 24 balls. Place on an oiled baking sheet. Brush with olive oil.

  5. 5

    Bake at 400°F for 25 minutes, flipping halfway, until golden and crispy.

  6. 6

    Serve in pita with tahini sauce, tomatoes, cucumbers, and pickled onions.

Expert Tips

For the best result, use the freshest, highest-quality ingredients you can find. Dried chickpeas, soaked overnight is the heart of this dish, so choose it with care. Read the recipe through before you start and prep all ingredients in advance (mise en place) so the cooking process is smooth. Sheet pan work especially well for this preparation. Taste and adjust salt, pepper, and acid at the end to make the flavors pop.

What To Serve With This

"Crispy Baked Falafel" is a versatile Dinner dish that pairs beautifully with a crisp green salad, roasted vegetables, crusty bread or dinner rolls and classic Middle Eastern sides. Choose at least one fresh and one hearty side to create a balanced meal.

Storage & Reheating

Crispy Baked Falafel keeps well in an airtight container in the refrigerator for 3–4 days. Let it cool to room temperature before refrigerating to preserve texture. Reheat gently on the stovetop or in the microwave, adding a splash of water or broth if the dish thickens in the fridge. You can also freeze portions for up to 3 months; thaw overnight in the refrigerator before reheating.

Nutrition Facts (per serving)

407
Calories
33g
Protein
20g
Fat
38g
Carbs
4g
Fiber
7g
Sugar
662mg
Sodium

Frequently Asked Questions

How long does it take to make Crispy Baked Falafel?

This recipe takes about 20 minutes of prep and 25 minutes of cooking, for a total of roughly 45 minutes. It serves 6 and is rated Medium.

How do I store leftover Crispy Baked Falafel?

Store leftover Crispy Baked Falafel in an airtight container in the refrigerator for up to 3-4 days. Make sure to let it cool to room temperature before refrigerating. Reheat in the oven or on the stovetop for best results.

Can I make Crispy Baked Falafel ahead of time?

Yes, you can prepare Crispy Baked Falafel in advance. Store it in an airtight container in the refrigerator for up to 3 days. Reheat gently before serving to preserve the best texture and flavor.

Reviews

No reviews yet. Be the first to review this recipe!